PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 308aa    MW: 35228.2 Da    PI: 6.3198
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-29685PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41.1e-1784137356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Lsa004859  84 KKRRLNMEQVKTLERNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 137
                456899***********************************************9 PP

2HD-ZIP_I/II131.23.9e-4283175193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+aLkr+++a+k+en++L++++++L++e+++
    Lsa004859  83 EKKRRLNMEQVKTLERNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDALKRQFEAVKAENDSLQSQNHKLHAEIMA 175
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-1960140IPR009057Homeodomain-like
SuperFamilySSF466895.13E-1981141IPR009057Homeodomain-like
SMARTSM003893.4E-1782143IPR001356Homeobox domain
PROSITE profilePS5007116.55283139IPR001356Homeobox domain
PfamPF000464.5E-1584137IPR001356Homeobox domain
CDDcd000861.42E-1584140No hitNo description
PRINTSPR000311.3E-5110119IPR000047Helix-turn-helix motif
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5119135IPR000047Helix-turn-helix motif
PfamPF021835.7E-16139179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAFFSTNFML QSSQEDDHHA PTSLTPILPP CTTTQDFSGV ASFLGKRSMS YSGVNNMDGC  60
DQEGNMNGED DLSDDGSQLL AGEKKRRLNM EQVKTLERNF ELGNKLEPER KMQLARALGL  120
QPRQIAIWFQ NRRARWKTKQ LEKDYDALKR QFEAVKAEND SLQSQNHKLH AEIMALKNRE  180
PTELINLNIK ETEGSCSNRS ENSSEIKLDI SRTPATDSPL SSHQHQHQHH QQPIPNLFPS  240
SNIERPNTNN IVAHQLFHNS SLRPADHQLH CQKIDQSSAI KEECFSNMFV GMEDQSGFWP  300
WLEQPQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520111.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-13
RefseqXP_015575250.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-113ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLF2X0U30.0F2X0U3_HELAN; HD-Zip subfamily I trancription factor
STRINGVIT_01s0026g01950.t011e-146(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-114HD-ZIP family protein